DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and Cfd

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001071110.1 Gene:Cfd / 54249 RGDID:2498 Length:263 Species:Rattus norvegicus


Alignment Length:254 Identity:75/254 - (29%)
Similarity:128/254 - (50%) Gaps:23/254 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VILLSAVACALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTA 69
            :::|.|..|          :.|..|||:||......:.|:..|:|.:|:|.|||::.....:::|
  Rat    10 LVVLEAAVC----------VAQPRGRILGGQEAMAHARPYMASVQVNGTHVCGGTLVDEQWVLSA 64

  Fly    70 AHCLQSVSA-SVLQIRAGSSYWSSGGV---TFSVSSFKNHEGYNANTMVNDIAIIKINGALTFSS 130
            |||:..|:. .|:|:..|:...||...   .:.|.|...|.|...:::.:|:.:.|::...:...
  Rat    65 AHCMDGVTKDEVVQVLLGAHSLSSPEPYKHLYDVQSVVLHPGSRPDSVEDDLMLFKLSHNASLGP 129

  Fly   131 TIKAIGLASSN----PANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQI 191
            .::.:.|...:    |  |....|:|||.:::.... |..||.:.|:|:.::.|...||..|: |
  Rat   130 HVRPLPLQREDREVKP--GTLCDVAGWGVVTHAGRR-PDVLQQLTVSIMDRNTCNLRTYHDGA-I 190

  Fly   192 RSTMICAAASGKDACQGDSGGPLVSGGVLVGVVSWGYG-CAYSNYPGVYADVAALRSWV 249
            ...|:||.::.:|.|:||||||||.|..:..||:||.. |.....|||:..||....|:
  Rat   191 TKNMMCAESNRRDTCRGDSGGPLVCGDAVEAVVTWGSRVCGNRRKPGVFTRVATYVPWI 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 69/227 (30%)
CfdNP_001071110.1 Tryp_SPc 26..252 CDD:238113 69/228 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.