DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and PLG

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_000292.1 Gene:PLG / 5340 HGNCID:9071 Length:810 Species:Homo sapiens


Alignment Length:270 Identity:82/270 - (30%)
Similarity:123/270 - (45%) Gaps:62/270 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 VPEGLLPQLD------------GRIVGGSATTISSFPWQISLQ-RSGSHSCGGSIYSSNVIVTAA 70
            ||:...|..|            ||:|||......|:|||:||: |.|.|.|||::.|...::|||
Human   557 VPQCAAPSFDCGKPQVEPKKCPGRVVGGCVAHPHSWPWQVSLRTRFGMHFCGGTLISPEWVLTAA 621

  Fly    71 HCLQ-SVSASVLQIRAGSSYWSSGGVTFSVSSFKNHEGYNANTMV--------------NDIAII 120
            |||: |...|..::..|:                 |:..|....|              .|||::
Human   622 HCLEKSPRPSSYKVILGA-----------------HQEVNLEPHVQEIEVSRLFLEPTRKDIALL 669

  Fly   121 KINGALTFSSTIKAIGLASSN--PANGAAASVSGWGTL--SYGSSSIPSQLQYVNVNIVSQSQCA 181
            |::.....:..:....|.|.|  .|:.....::|||..  ::|:    ..|:...:.::....| 
Human   670 KLSSPAVITDKVIPACLPSPNYVVADRTECFITGWGETQGTFGA----GLLKEAQLPVIENKVC- 729

  Fly   182 SSTYGY-GSQIRSTMICAA--ASGKDACQGDSGGPLV----SGGVLVGVVSWGYGCAYSNYPGVY 239
             :.|.: ..:::||.:||.  |.|.|:||||||||||    ...:|.||.|||.|||..|.||||
Human   730 -NRYEFLNGRVQSTELCAGHLAGGTDSCQGDSGGPLVCFEKDKYILQGVTSWGLGCARPNKPGVY 793

  Fly   240 ADVAALRSWV 249
            ..|:...:|:
Human   794 VRVSRFVTWI 803

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 76/245 (31%)
PLGNP_000292.1 PAN_AP_HGF <38..97 CDD:238532
KR 101..183 CDD:214527
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 126..145
KR 183..263 CDD:214527
KR 273..354 CDD:214527
KR 375..456 CDD:214527
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 396..416
KR 479..560 CDD:214527 2/2 (100%)
Tryp_SPc 580..803 CDD:214473 76/245 (31%)
Tryp_SPc 581..804 CDD:238113 76/246 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.