DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and PLAU

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_002649.2 Gene:PLAU / 5328 HGNCID:9052 Length:431 Species:Homo sapiens


Alignment Length:248 Identity:84/248 - (33%)
Similarity:130/248 - (52%) Gaps:28/248 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RIVGGSATTISSFPWQISLQR-----SGSHSCGGSIYSSNVIVTAAHCL------QSVSASVLQI 83
            :|:||..|||.:.||..::.|     |.::.||||:.|...:::|.||.      :.....:.:.
Human   178 KIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRS 242

  Fly    84 RAGSSYWSSGGVTFSVSSFKNHEGYNANTMV--NDIAIIKING----ALTFSSTIKAIGLAS--S 140
            |..|:  :.|.:.|.|.:...|:.|:|:|:.  ||||::||..    ....|.||:.|.|.|  :
Human   243 RLNSN--TQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYN 305

  Fly   141 NPANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTMICAAAS--GK 203
            :|..|.:..::|:|..:......|.||:...|.::|..:|....| |||::.:.|:|||..  ..
Human   306 DPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHY-YGSEVTTKMLCAADPQWKT 369

  Fly   204 DACQGDSGGPLVSG----GVLVGVVSWGYGCAYSNYPGVYADVAALRSWVISN 252
            |:||||||||||..    ..|.|:||||.|||..:.||||..|:....|:.|:
Human   370 DSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSH 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 82/243 (34%)
PLAUNP_002649.2 Binds urokinase plasminogen activator surface receptor. /evidence=ECO:0000250 34..57
KR 67..152 CDD:238056
Connecting peptide 152..177
Tryp_SPc 179..422 CDD:238113 83/245 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.