DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and Prss44

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_008764869.1 Gene:Prss44 / 501060 RGDID:1560940 Length:373 Species:Rattus norvegicus


Alignment Length:236 Identity:83/236 - (35%)
Similarity:123/236 - (52%) Gaps:20/236 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTAAHCLQSVSASVLQIRAGSSYWSSGG 94
            |||||....|..:|||:|||....|.||||:.|...::|||||:......|:.: ..:..|||..
  Rat   112 RIVGGKPAPIRKWPWQVSLQVHKQHICGGSLISKWWVMTAAHCVYGHLDYVVSM-GEADLWSSMS 175

  Fly    95 VTFSVSSFKNHEGYNA-NTMVNDIAIIKINGALTFSSTIKAIGLASSN----PANGAAASVSGWG 154
            |...|.....|:.|:. .|:|:|||::.:...:.:|..|:.:.:...:    |  |....|:|||
  Rat   176 VKIPVQDIIVHQDYSVMRTIVHDIALVLLAFPVNYSVNIQPVCIPEKSFLVQP--GTLCWVTGWG 238

  Fly   155 -TLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTM----ICA-AASGKDACQGDSGGP 213
             |:..|.||  ..|:.|:::|:...:|.........:|.:.:    :|. ...|.||||||||||
  Rat   239 KTIERGRSS--RVLREVDLSIIRHERCNQILKDITGRIFTLVQEGGVCGYNKKGGDACQGDSGGP 301

  Fly   214 LV----SGGVLVGVVSWGYGCAYSNYPGVYADVAALRSWVI 250
            :|    ...|.||:||||.||....|||:|.:|:..|.|:|
  Rat   302 MVCEFNKTWVQVGIVSWGLGCGRIGYPGIYTEVSYYRDWII 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 81/233 (35%)
Prss44XP_008764869.1 Tryp_SPc 112..341 CDD:214473 81/233 (35%)
Tryp_SPc 113..341 CDD:238113 80/232 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.