DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and cela1.2

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001011493.1 Gene:cela1.2 / 496993 XenbaseID:XB-GENE-5739190 Length:265 Species:Xenopus tropicalis


Alignment Length:268 Identity:90/268 - (33%)
Similarity:147/268 - (54%) Gaps:20/268 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKFVILLSAVACALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQ--RSGS--HSCGGSIY 61
            ||:.::|.:.|.|  |....:..|.:...|::||:....:|:|||:|||  ..||  |:||||:.
 Frog     1 MLRLLVLAAFVLC--GQCSNDIRLIEDHERVIGGTEVQRNSWPWQVSLQYLSGGSWYHTCGGSLI 63

  Fly    62 SSNVIVTAAHCLQSVSASVLQIRAGSSYWSSGGVTF-SVSSFKNHEGYNANTMV--NDIAIIKIN 123
            .:|.::|||||:....:..:.:...:.|.:.|...: |||....|..:|.|.:.  .||:|:.::
 Frog    64 RANRVLTAAHCVDRAVSYRVVVGDHNIYQNDGTEQYISVSRIVKHANWNPNNIAAGYDISILHLS 128

  Fly   124 GALTFSSTIKAIGLASSNP--ANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYG 186
            .:.|.:|.:|...|.:.|.  |:.....|:|||..| .:.::.|.||...:.:::.|.|:|.:| 
 Frog   129 SSATLNSYVKLAQLPADNVVLAHNYNCVVTGWGKTS-NNGNLASVLQQAPLPVIAHSTCSSGSY- 191

  Fly   187 YGSQIRSTMICAAASG-KDACQGDSGGPL---VSGGVLV-GVVSW--GYGCAYSNYPGVYADVAA 244
            :||.::|||:||...| :..|||||||||   |:|...| ||.|:  ..||:....|.|:..|:|
 Frog   192 WGSTVKSTMVCAGGDGVRSGCQGDSGGPLNCPVNGVYQVHGVTSFVSSSGCSTYLKPTVFTRVSA 256

  Fly   245 LRSWVISN 252
            ...|:.:|
 Frog   257 YIGWINNN 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 81/234 (35%)
cela1.2NP_001011493.1 Tryp_SPc 29..264 CDD:238113 81/236 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.