DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and zgc:92590

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001007055.1 Gene:zgc:92590 / 474322 ZFINID:ZDB-GENE-041024-15 Length:247 Species:Danio rerio


Alignment Length:257 Identity:96/257 - (37%)
Similarity:134/257 - (52%) Gaps:23/257 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKFVILLSAVACALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISL-QRSGSHSCGGSIYSSN 64
            |:.|.:|:.||||:            .|.:|:||...:.:|.||||.| ..:|...||.|:.:..
Zfish     3 MIVFALLVLAVACS------------ADDKIIGGYECSPNSQPWQIYLTYDNGQRWCGASLINDR 55

  Fly    65 VIVTAAHCLQSVSASVLQIRAGS-SYWSSGGVTFSVSSFK--NHEGYNANTMVNDIAIIKINGAL 126
            ..|:||||.  :.|:.|.:..|. :.....|....:.:.|  .|..||..|:.||..:||:....
Zfish    56 WAVSAAHCY--LVANRLTVHLGEHNVAVEEGTEQRIKAEKVIPHPKYNDYTLDNDFMLIKLKEPA 118

  Fly   127 TFSSTIKAIGLASSNPANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQI 191
            .|:..::.:.|.:|..:.|....|||||.|.......|..||.:|:.:::::||..:   ||.||
Zfish   119 VFNQYVQPVPLTTSCSSEGEQCLVSGWGNLINTGVVYPDVLQCLNLPVLTRAQCEGA---YGWQI 180

  Fly   192 RSTMICAA--ASGKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYADVAALRSWVIS 251
            ...|.||.  ..||||||||||||::..|.|.||||||||||.|.|||||.:|.....||.|
Zfish   181 TKNMFCAGFMEGGKDACQGDSGGPVICNGELRGVVSWGYGCADSGYPGVYTEVCRYTDWVAS 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 85/224 (38%)
zgc:92590NP_001007055.1 Tryp_SPc 20..240 CDD:214473 85/224 (38%)
Tryp_SPc 21..243 CDD:238113 88/227 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 181 1.000 Inparanoid score I3969
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.870

Return to query results.
Submit another query.