DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and AgaP_AGAP012671

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_001230557.2 Gene:AgaP_AGAP012671 / 4578478 VectorBaseID:AGAP012671 Length:216 Species:Anopheles gambiae


Alignment Length:210 Identity:64/210 - (30%)
Similarity:107/210 - (50%) Gaps:13/210 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 HSCGGSIYSSNVIVTAAHCLQSVSASVLQIR--AGSSYWSSGGVTFSVSSFKNHEGYNANTMVN- 115
            ::.|.:|.:....:|||||:....:..:::.  .||:...:|||.|||.....|.||:.:...: 
Mosquito     8 YAVGATIITHKHALTAAHCVYPQRSEPMRVSLYGGSTSAVTGGVLFSVVRIAVHPGYDHSYFPDA 72

  Fly   116 ---DIAIIKI-NGALTFSSTIKAIGLASSNPANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVS 176
               |:|::.: |.|.:..|.:.::.|.:|....|....|:|||.......:..:||:|..:.||.
Mosquito    73 SEYDVAVLTVANNAFSGKSNMASLILQTSEQPIGTRCFVAGWGRTGNNEPASLNQLRYAEMTIVD 137

  Fly   177 QSQCASSTYGYGSQ-IRSTMICAAASGKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYA 240
            ||.||.:...|..| :.|...   .:|.|.|:|||||.||.||.|.||||:......|.:|..::
Mosquito   138 QSTCARAWATYPRQRVTSKKY---GNGVDTCKGDSGGALVCGGGLAGVVSFTNLECTSAWPAGFS 199

  Fly   241 DVAA--LRSWVISNA 253
            .::|  :|.::.:.|
Mosquito   200 KISAPSIRRFISTEA 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 63/204 (31%)
AgaP_AGAP012671XP_001230557.2 Tryp_SPc 11..203 CDD:214473 61/194 (31%)
Tryp_SPc 11..202 CDD:238113 61/193 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.