DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and AgaP_AGAP012470

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_001230511.2 Gene:AgaP_AGAP012470 / 4578462 VectorBaseID:AGAP012470 Length:272 Species:Anopheles gambiae


Alignment Length:241 Identity:74/241 - (30%)
Similarity:109/241 - (45%) Gaps:38/241 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 GRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTAAHC--------LQSVSAS------ 79
            ||:|.|....|..:.:.:||:....:.||.||.:.:..:|:|.|        :...|||      
Mosquito    44 GRLVNGIGVRIERYKFAVSLRYFNQYVCGASIITPSHALTSAFCATKYLHVNIYGSSASTISGGI 108

  Fly    80 ---VLQIRAGSSYWSSGGVTFSVSSFKNHEGYNANTMVNDIAIIKINGALTFSSTIKAIGLASSN 141
               |:||....||   .|:||.|.:|             |:|::.:.......:.:..|.|.|:.
Mosquito   109 EIPVVQIVVHPSY---VGLTFGVPNF-------------DVAVVIVPTNAFQGTNMAPIALQSTE 157

  Fly   142 PANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTMICAA-ASGKDA 205
            ....:...:.|||..:..|.:..:||:|.::||||||.|..|.||.  .|.|..|||. ..|.||
Mosquito   158 LPVESRCYLVGWGETNVISFASLTQLRYASMNIVSQSTCTRSWYGV--PITSERICARYCFGVDA 220

  Fly   206 CQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYADVAA--LRSWV 249
            |:.|.|.|||..|.|.|.||..........|.::..|||  :||::
Mosquito   221 CRSDIGSPLVCNGKLTGFVSITSNNCDGVRPAIFTKVAAPSIRSFI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 73/238 (31%)
AgaP_AGAP012470XP_001230511.2 Tryp_SPc 45..259 CDD:214473 69/231 (30%)
Tryp_SPc 47..269 CDD:238113 72/238 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.