DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and AgaP_AGAP010240

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_001238153.2 Gene:AgaP_AGAP010240 / 4578338 VectorBaseID:AGAP010240 Length:275 Species:Anopheles gambiae


Alignment Length:276 Identity:91/276 - (32%)
Similarity:138/276 - (50%) Gaps:34/276 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKFVILLSAVACALGGTVP---------EGLLP----QLDGRIVGGSATTISSFPWQISLQRSG 52
            |..|::::.|...|:...:|         :.::|    ....|||.|...::..||:|:.|...|
Mosquito     1 MKLFIVVVLACLAAVQVRLPPQNAREISYQSIVPFREATRSSRIVNGFPASLGQFPYQVFLIGDG 65

  Fly    53 SHSCGGSIYSSNVIVTAAHCLQSVSASVLQIRAGSSYWSSGGVTFSVSSFKNHEGYNANTMVNDI 117
            |.:||||:.|:..::|||||  .|..|...:||||...:|||...:.:....|..||.:.:.|||
Mosquito    66 SLACGGSLISAEWVLTAAHC--QVGISQFTVRAGSIQNNSGGTVRTSNLIIIHPNYNPSNLNNDI 128

  Fly   118 AIIKINGALTFSSTIKAIGLASSNPAN---GAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQ 179
            .:|::|..:.....|:.:.|..:|.:.   ...|:|||:|..|..|.:|...|.:|::||:|..|
Mosquito   129 GLIRLNEPMPLGGNIQVVALPEANLSETFLNREATVSGFGRTSDASGAISPNLNFVHLNIISNIQ 193

  Fly   180 CASSTYGYGSQIRSTMICAAASGKDA-----CQGDSGGPLV----SGGVLVGVVSW--GYGCAYS 233
            | ..|||..:.|.|| :||.  |:||     |.|||||||.    ...|.:||||:  ..||.. 
Mosquito   194 C-MGTYGSATIIDST-VCAV--GRDAPNQGTCNGDSGGPLTVTENGQSVQIGVVSFVAAAGCEV- 253

  Fly   234 NYPGVYADVAALRSWV 249
            .:|..|......|:|:
Mosquito   254 GFPSGYVRTTHFRNWI 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 84/232 (36%)
AgaP_AGAP010240XP_001238153.2 Tryp_SPc 43..269 CDD:214473 84/232 (36%)
Tryp_SPc 44..272 CDD:238113 84/233 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.