DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and AgaP_AGAP010015

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_001238092.2 Gene:AgaP_AGAP010015 / 4577984 VectorBaseID:AGAP010015 Length:239 Species:Anopheles gambiae


Alignment Length:232 Identity:70/232 - (30%)
Similarity:112/232 - (48%) Gaps:17/232 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 GRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTAAHCLQSVSASVLQIRAGSSYWSSG 93
            |||:.|.......:|:.:::.......|.|:|.:.:.:::..:|.: :....:.|..|.:...||
Mosquito     8 GRILNGLKVNPERYPFIVNIYFEDQFLCSGNIITPSHVLSLEYCFE-IFVFQMSIYGGGTSPLSG 71

  Fly    94 GVTFSVSSFKNHEG--YNANTMVNDIAIIK--INGALTFS--STIKAIGLASSNPANGAAASVSG 152
            |::..|:....|..  |.......|:|:|.  ||   ||.  :.:.:|.|.:|....|:...|.|
Mosquito    72 GISIPVNKITIHPNFEYRYGRSDFDVAVISVPIN---TFQGMANMASIALQTSEVLPGSRCYVIG 133

  Fly   153 WGTLS-YGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTMICAA-ASGKDACQGDSGGPLV 215
            ||... :|...: :.|.|..:||||||.|:.|.......:.|.||||. ..|.|.|.||.|||||
Mosquito   134 WGVSKIFGPIDL-NGLHYGTMNIVSQSACSRSWASVNENVTSNMICAKYCFGVDICYGDLGGPLV 197

  Fly   216 SGGVLVGVVSW-GYGCAYSNYPGVYADVAA--LRSWV 249
            ..|.|.|::.: .|||..:| |.|:..:.|  :||::
Mosquito   198 CDGKLTGIIGYTEYGCTKNN-PAVFTRIMAPSIRSFI 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 69/229 (30%)
AgaP_AGAP010015XP_001238092.2 Tryp_SPc 9..224 CDD:214473 66/220 (30%)
Tryp_SPc 10..235 CDD:238113 68/230 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.