DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and AgaP_AGAP010619

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_001230717.2 Gene:AgaP_AGAP010619 / 4577722 VectorBaseID:AGAP010619 Length:280 Species:Anopheles gambiae


Alignment Length:213 Identity:72/213 - (33%)
Similarity:106/213 - (49%) Gaps:12/213 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 GRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTAAHCLQSVSASVLQIRAGSSYWSSG 93
            |||:.|.|:.|:::|:.||::|.|...|||::.|::..:|||..:.....|: .:..||:..:||
Mosquito    49 GRIINGFASDIANYPFAISVRRDGQFYCGGTVISASYALTAATPVYPYRNSI-TLYGGSTSANSG 112

  Fly    94 GVTFSVSSFKNHEGYNANTMVND--IAIIKI-NGALTFSSTIKAIGLASSNPANGAAASVSGWGT 155
            ||.|.|.....|..:|.|..|:|  |||:.: ..|......|..|.|||:..|.|...:|.|||.
Mosquito   113 GVLFKVLMIAVHLLFNPNDRVSDYNIAILTVPANAFGGRRNIAPIPLASAEVAIGTKCTVFGWGR 177

  Fly   156 LSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTMICA-AASGKDACQGDSGGPLVSGGV 219
            .:.......:.|:..::.|.|.:.||.:......|:.|.|||| ...|.|.|.||.|..||..|.
Mosquito   178 TNANLPGPANALRSADMVISSGATCARAWGPLSVQLTSNMICAKGVRGADLCIGDYGNALVCRGK 242

  Fly   220 LVGVVSWGYGCAYSNYPG 237
            |.|:       |:...||
Mosquito   243 LNGI-------AFLASPG 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 71/212 (33%)
AgaP_AGAP010619XP_001230717.2 Tryp_SPc 50..268 CDD:214473 71/212 (33%)
Tryp_SPc 51..268 CDD:238113 70/211 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.