DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and AgaP_AGAP010620

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_001230718.2 Gene:AgaP_AGAP010620 / 4577717 VectorBaseID:AGAP010620 Length:262 Species:Anopheles gambiae


Alignment Length:249 Identity:81/249 - (32%)
Similarity:119/249 - (47%) Gaps:14/249 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 CALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTAAHCLQSV- 76
            |.| ..:||....  .|||:.|.:..|:.:|:.:||:|.|...||.::.|.:..:|||..:... 
Mosquito    14 CGL-SEIPEAAAQ--SGRIINGFSVEIAKYPFVLSLRRDGKFDCGATVISLSHALTAAASIYPYR 75

  Fly    77 -SASVLQIRAGSSYWSSGGVTFSVSSFKNHEGYNANTMVND--IAIIKI-NGALTFSSTIKAIGL 137
             |...:.:..||:..:||||:|||.....|..||....|:|  ||::.: ..|......|..|.|
Mosquito    76 NSPQRMTLYGGSTSPTSGGVSFSVLRIAVHPNYNPIVRVSDFNIAVLTVPTNAFRAKRNIAPIPL 140

  Fly   138 ASSNPANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQ--IRSTMICAAA 200
            |||....|...||.|||:.:|...:..:.|:..::.|.|::.||.:.....|.  |.|.|:||..
Mosquito   141 ASSVVETGTKCSVFGWGSTNYYIPAPATTLRAADMVISSEATCARAWLQLPSPVVITSNMVCAKG 205

  Fly   201 S-GKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYADVAA--LRSWVIS 251
            . |.|.|.||||..||..|.|.||......|. :.....|..:.|  :||::.|
Mosquito   206 DRGADLCTGDSGNALVCSGRLTGVAILSNTCG-NGRDTAYTKITASSVRSFIRS 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 75/228 (33%)
AgaP_AGAP010620XP_001230718.2 Tryp_SPc 28..256 CDD:214473 75/228 (33%)
Tryp_SPc 29..259 CDD:238113 75/231 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.