DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and AgaP_AGAP004571

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_313875.2 Gene:AgaP_AGAP004571 / 4576898 VectorBaseID:AGAP004571 Length:324 Species:Anopheles gambiae


Alignment Length:268 Identity:90/268 - (33%)
Similarity:127/268 - (47%) Gaps:42/268 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SAVACALGGTVPEGLLPQLD-GRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTAAHC 72
            ||.:|..|        .:.| .|||||.||.::.|||...|.......|||.:.:...::|||||
Mosquito    68 SACSCRCG--------ERNDASRIVGGQATGVNEFPWMARLSYFNRFYCGGMLINDRYVLTAAHC 124

  Fly    73 LQSVSASVLQIRAGSSYWSSGGVTFSVS----------SFKNHEGYNANTMVNDIAIIKINGALT 127
            ::.....::::..|........|.....          ||.|.:        ||||::::|..:.
Mosquito   125 VKGFMWFMIKVTFGEHNRCDDSVRPETRFVLRAIAQKFSFLNFD--------NDIALLRLNDRVP 181

  Fly   128 FSSTIKAIGLASSNPAN---GAAASVSGWGTLSYGSSSIPS-QLQYVNVNIVSQSQCASSTYGYG 188
            .:..|:.|.| .|:|:|   |...:.:|||||.  ....|| .||.|.|.::|...|::.|....
Mosquito   182 ITDFIRPICL-PSDPSNAYVGTNGTATGWGTLK--EDGKPSCILQEVEVPVLSNEVCSTQTNYTA 243

  Fly   189 SQIRSTMICAAASG---KDACQGDSGGPLVSGG-----VLVGVVSWGYGCAYSNYPGVYADVAAL 245
            |.|...|:||...|   ||:|||||||||::..     .|:||||||.|||...|||||..|...
Mosquito   244 SMITDNMLCAGYLGVGEKDSCQGDSGGPLIAEREDKRYELIGVVSWGNGCARPYYPGVYTRVTRY 308

  Fly   246 RSWVISNA 253
            ..|:..|:
Mosquito   309 LDWIRENS 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 83/240 (35%)
AgaP_AGAP004571XP_313875.2 Tryp_SPc 82..312 CDD:214473 83/240 (35%)
Tryp_SPc 83..315 CDD:238113 83/242 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.