DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and AgaP_AGAP006710

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_565496.1 Gene:AgaP_AGAP006710 / 4576607 VectorBaseID:AGAP006710 Length:258 Species:Anopheles gambiae


Alignment Length:223 Identity:77/223 - (34%)
Similarity:117/223 - (52%) Gaps:7/223 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RIVGGSATTISSFPWQISLQRSG-SHSCGGSIYSSNVIVTAAHCLQSVSASVLQIRAGSSYWSSG 93
            |:|||......|.|:|:|||..| .|:||||:.::..::||||||.....|.|.:..|::....|
Mosquito    32 RVVGGEVAKNGSAPYQVSLQVPGWGHNCGGSLLNNRWVLTAAHCLVGYEPSDLMVLVGTNSLKEG 96

  Fly    94 GVTFSVSSFKNHEGYNANTMVNDIAIIKINGALTFSSTIKAIG-LASSNPANGAAASVSGWGTLS 157
            |....|.....|..||.....|||.::::...:.||..::::. |..:.|.| |...::|||..|
Mosquito    97 GELLKVDKLLYHSRYNRPQFHNDIGLMRLEQPVQFSELVQSVEYLEKAVPVN-ATVRLTGWGRTS 160

  Fly   158 YGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTMICA-AASGKDACQGDSGGPLVSGGVLV 221
             .:.::|:.||.:||..:|...| .:..|....:....:|. ..:|:.||.||||||||..|.||
Mosquito   161 -TNGNVPTLLQSLNVVTLSNEDC-KAKMGNPENVDLGHVCTLTKAGEGACNGDSGGPLVYEGKLV 223

  Fly   222 GVVSWGYGCAYSNYPGVYADVAALRSWV 249
            |||::|..|. ..:|..:|.|:....||
Mosquito   224 GVVNFGVPCG-RGFPDGFARVSYYHEWV 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 75/221 (34%)
AgaP_AGAP006710XP_565496.1 Tryp_SPc 32..250 CDD:214473 75/221 (34%)
Tryp_SPc 33..253 CDD:238113 76/222 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.