DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and AgaP_AGAP012778

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_001230340.2 Gene:AgaP_AGAP012778 / 4397620 VectorBaseID:AGAP012778 Length:276 Species:Anopheles gambiae


Alignment Length:263 Identity:72/263 - (27%)
Similarity:116/263 - (44%) Gaps:39/263 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 AVACALGGTVPEGLLP---QLDG---RIVGGSATTISSFPWQIS----LQRSGSHSCGGSIYSSN 64
            |:||         |||   |.|.   ||:||||.|..|  |.::    :..:.|:.|||::....
Mosquito    25 ALAC---------LLPLAVQADAGSQRIIGGSAVTAPS--WMVAVGEVVNGNWSNFCGGTLIDKQ 78

  Fly    65 VIVTAAHCLQSVSASVLQIRAGSSYWSSGGVTFSVSSFKNHEGYNANTMVN----------DIAI 119
            .::|||||:.:..:..:::..|.|..|.......|.....|..|..|.:.|          |:|:
Mosquito    79 WVLTAAHCVANAQSGPMEVAIGVSDLSRPHTRSKVDQVLMHPEYYVNLLSNLGYRETPYSSDVAL 143

  Fly   120 IKINGALTFSSTIKA-IGLASSNPANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASS 183
            :.:...:|.:..:.| |....:...|.......|:|.::..::....||..|::     :.....
Mosquito   144 LHLATPVTQAPIVMADITTKDTWQWNTTMLHAIGYGGINPDATKSSPQLLAVDL-----AYRGER 203

  Fly   184 TYGYGSQIRSTMICAAASGKDACQGDSGGPLVSGGVLVGVVSWG-YGCAYSNYPGVYADVAALRS 247
            .|.||....:.:.....:|:|.|:|||||||..||.||||.|:| :.|| :...|.|....|...
Mosquito   204 DYWYGDPTTTHIFAGKLAGQDTCKGDSGGPLTYGGKLVGVTSYGAFPCA-TGSAGGYTYAPAFSD 267

  Fly   248 WVI 250
            |::
Mosquito   268 WIV 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 63/234 (27%)
AgaP_AGAP012778XP_001230340.2 Tryp_SPc 42..269 CDD:214473 63/234 (27%)
Tryp_SPc 43..269 CDD:238113 62/233 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.