DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and AgaP_AGAP012842

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_001230353.1 Gene:AgaP_AGAP012842 / 4397614 VectorBaseID:AGAP012842 Length:110 Species:Anopheles gambiae


Alignment Length:103 Identity:47/103 - (45%)
Similarity:61/103 - (59%) Gaps:5/103 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 VSGWG-TLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTMICAA--ASGKDACQGDSG 211
            ||||| |||...|:  ..|:..||..|:|.:|..:.......|...|.||.  ..|:|.|:.|||
Mosquito     4 VSGWGLTLSDADSN--DVLRATNVPTVNQQECNKAYQSMYGGITDQMFCAGYKQGGQDTCRQDSG 66

  Fly   212 GPLVSGGVLVGVVSWGYGCAYSNYPGVYADVAALRSWV 249
            ||.|:.|.|:||:|||:.||.:.||||||.||:.|.|:
Mosquito    67 GPFVAEGKLIGVISWGHECALAGYPGVYARVASARDWI 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 46/101 (46%)
AgaP_AGAP012842XP_001230353.1 Tryp_SPc <1..107 CDD:238113 47/103 (46%)
Tryp_SPc <1..104 CDD:214473 46/101 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.