DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and AgaP_AGAP012492

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_001230278.2 Gene:AgaP_AGAP012492 / 4397588 VectorBaseID:AGAP012492 Length:266 Species:Anopheles gambiae


Alignment Length:236 Identity:76/236 - (32%)
Similarity:119/236 - (50%) Gaps:19/236 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 GRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTAAHCLQS--VSASVLQIRAGSSYWS 91
            |||:.|...:|..:.:.:||:....:.|||||.|.:.:::|.||:..  .:.|.:.|..||:...
Mosquito    23 GRIINGVPVSIEIYKFAVSLRVDNRYYCGGSIISVSHVLSAGHCVYPFLTNVSRMSIYGGSTSPF 87

  Fly    92 SGGVTFSVSSFKNHEGYNANTMVN----DIAIIKI-NGALTFSSTIKAIGLASSNPANGAAASVS 151
            |||::..|....||..||.|....    |:|::.: ..||.....:..|.:.:.....|....|.
Mosquito    88 SGGISIPVIRAVNHPDYNPNPPFGIHDFDVAVLTVPRNALRGRPNMAPIAIQNVQIPAGTRCYVV 152

  Fly   152 GWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQ-----IRSTMICAAAS-GKDACQGDS 210
            |||...:.:.:.|::|.|:|:.||||..|||:.    ||     |.|.||||..: |.|.|:|||
Mosquito   153 GWGWTDFNARTNPTELHYLNMAIVSQDSCASAY----SQVNIWGINSNMICAKGNQGTDTCKGDS 213

  Fly   211 GGPLVSGGVLVGVVSWGYGCAYSNYPGVYADVA--ALRSWV 249
            |..||.||.|.|:.|:......::.|...|.:.  ::||::
Mosquito   214 GSALVCGGRLTGISSFTSSMCKTDLPAGLAKLTDPSIRSFI 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 75/233 (32%)
AgaP_AGAP012492XP_001230278.2 Tryp_SPc 24..246 CDD:214473 73/225 (32%)
Tryp_SPc 25..229 CDD:238113 69/207 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.870

Return to query results.
Submit another query.