DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and AgaP_AGAP012491

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_001230277.2 Gene:AgaP_AGAP012491 / 4397584 VectorBaseID:AGAP012491 Length:272 Species:Anopheles gambiae


Alignment Length:254 Identity:93/254 - (36%)
Similarity:129/254 - (50%) Gaps:17/254 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SAVACALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTAAHCL 73
            :.|..|.|....||  |...||||.|....||::.:.:|::..|...||.||.:.:..:|||||:
Mosquito    17 AVVTNANGQNTTEG--PSHSGRIVNGIPVNISNYKYALSMRFDGEFICGASIITYSHALTAAHCV 79

  Fly    74 QSVS--ASVLQIRAGSSYWSSGGVTFSVSSFKNHEGYNANTMVN----DIAIIKINGALTFSS-- 130
            .:..  :|.|.:..||:..|||||.|.|.....|..|..|:..|    |:||:.: .|.:||.  
Mosquito    80 YNYQFMSSRLTLYGGSTSASSGGVEFPVVGGAIHPYYKPNSQSNTSDYDVAILNV-PANSFSGRP 143

  Fly   131 TIKAIGLASSNPANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRST- 194
            .:..:.|.:.....|....|.|||..........:||.|.|:||||||.|||....:....... 
Mosquito   144 NMAPLALQTKELPVGTRCFVVGWGRTGENQPVSTNQLLYANMNIVSQSSCASMWANFEKLCAECK 208

  Fly   195 -MICAA-ASGKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYADVAA--LRSWV 249
             |:||. .:|.|.|:|||||.||.||.|.||||:|..|: ..:|.|:|.|.|  :||::
Mosquito   209 HMVCAQYYNGMDTCRGDSGGALVCGGRLTGVVSFGPYCS-GVWPSVFAKVTAPSMRSFI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 86/231 (37%)
AgaP_AGAP012491XP_001230277.2 Tryp_SPc 36..266 CDD:214473 86/231 (37%)
Tryp_SPc 37..267 CDD:238113 85/232 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.