DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and KLK12

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_062544.1 Gene:KLK12 / 43849 HGNCID:6360 Length:254 Species:Homo sapiens


Alignment Length:262 Identity:88/262 - (33%)
Similarity:126/262 - (48%) Gaps:57/262 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKFVILLSAVACALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVI 66
            |...:||    |.||  :.:...|    :|..|:....:|.|||:.|....|..|||.:.....:
Human     3 LSIFLLL----CVLG--LSQAATP----KIFNGTECGRNSQPWQVGLFEGTSLRCGGVLIDHRWV 57

  Fly    67 VTAAHCLQSVSASVLQIRAGSSYW------------------SSGGVTFSVSSFKNHEGY-NANT 112
            :|||||            :||.||                  .||   |||:    |.|| .|:|
Human    58 LTAAHC------------SGSRYWVRLGEHSLSQLDWTEQIRHSG---FSVT----HPGYLGAST 103

  Fly   113 M-VNDIAIIKINGALTFSSTIKAIGLASSNPANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVS 176
            . .:|:.::::...:..:|:::.:.|.:.....|....|||||..::..:..|..||.:|::|||
Human   104 SHEHDLRLLRLRLPVRVTSSVQPLPLPNDCATAGTECHVSGWGITNHPRNPFPDLLQCLNLSIVS 168

  Fly   177 QSQCASSTYG-YGSQIRSTMICA-AASGKDACQGDSGGPLVSGGVLVGVVSWGY--GCAYSNYPG 237
            .:.|    :| |..:|.|.|:|| ...|:||||||||||||.||||.|:||||.  .|.....||
Human   169 HATC----HGVYPGRITSNMVCAGGVPGQDACQGDSGGPLVCGGVLQGLVSWGSVGPCGQDGIPG 229

  Fly   238 VY 239
            ||
Human   230 VY 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 81/234 (35%)
KLK12NP_062544.1 Tryp_SPc 21..236 CDD:214473 81/234 (35%)
Tryp_SPc 22..236 CDD:238113 81/233 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.