DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and KLK14

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001298111.2 Gene:KLK14 / 43847 HGNCID:6362 Length:251 Species:Homo sapiens


Alignment Length:254 Identity:86/254 - (33%)
Similarity:126/254 - (49%) Gaps:19/254 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FVILLSAVACALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHS--CGGSIYSSNVI 66
            |::|.:....|:..|..:    :.:.:|:||...|.||.|||.:|.......  |||::.|...:
Human     2 FLLLTALQVLAIAMTQSQ----EDENKIIGGHTCTRSSQPWQAALLAGPRRRFLCGGALLSGQWV 62

  Fly    67 VTAAHCLQSVSASVLQIRAGS---SYWSSGGVTFSVSSFKNHEGYNANTMVNDIAIIKINGALTF 128
            :|||||    ...:||:..|.   ..|.:......|.....|..||:.|..||:.::::......
Human    63 ITAAHC----GRPILQVALGKHNLRRWEATQQVLRVVRQVTHPNYNSRTHDNDLMLLQLQQPARI 123

  Fly   129 SSTIKAIGLASSNPANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRS 193
            ...::.|.:..:..:.|.:..||||||:|...:..|:.||.||:||.....|..:   |...|..
Human   124 GRAVRPIEVTQACASPGTSCRVSGWGTISSPIARYPASLQCVNINISPDEVCQKA---YPRTITP 185

  Fly   194 TMICAAA--SGKDACQGDSGGPLVSGGVLVGVVSWGY-GCAYSNYPGVYADVAALRSWV 249
            .|:||..  .|||:||||||||||..|.|.|:||||. .||...|||||.::...|||:
Human   186 GMVCAGVPQGGKDSCQGDSGGPLVCRGQLQGLVSWGMERCALPGYPGVYTNLCKYRSWI 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 81/226 (36%)
KLK14NP_001298111.2 Tryp_SPc 25..247 CDD:238113 82/227 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8473
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.