DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and CG34130

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001036759.1 Gene:CG34130 / 4379866 FlyBaseID:FBgn0083966 Length:297 Species:Drosophila melanogaster


Alignment Length:284 Identity:67/284 - (23%)
Similarity:124/284 - (43%) Gaps:60/284 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKFVILLSAVACA-----------LGGTVPEGLLPQLDG--RIVGGSATTISSFPWQISLQRSG 52
            :....:||:.|..|           |.|..|...|.: :|  |..||.|.     ||.:.:....
  Fly     7 IFSIALLLTEVGAAHSSWWNSSASYLHGRPPVRTLNK-NGIRRTSGGHAV-----PWLLRIVDGP 65

  Fly    53 SHSCGGSIYSSNVIVTAAHCL-----QSVSASVLQIRAGSSYWSSGGVTFSVSSFKNHEGYNA-- 110
            :..||.|..|:...:|:|:|:     |..|.||..:.:.|.         ..:...:|:..||  
  Fly    66 TFVCGASYLSALYALTSANCMHSHRSQMESLSVELVSSDSR---------QDNQLDSHDPPNALI 121

  Fly   111 -NTMVN----------DIAIIKINGALTFSSTIKAIGLASSNPANGAAASVSGWGTLSYGSSSIP 164
             |.:|:          |:|:|::...|. .:....:.|. :||    .:|......:|||:.  |
  Fly   122 RNIIVSKDWHWPGTFMDVAVIELTNRLR-GNRNNYVTLC-TNP----LSSYKSLSVVSYGAG--P 178

  Fly   165 SQ-LQYVNVNIVSQSQCASSTYGYGS-QIRSTMICAAASGKDA-CQGDSGGPLVSGGVLVGVVSW 226
            :: ::...:.::::..|.|:   ||: .:|.|:.||....:.| |...:|.|:.:|..|.|:|:|
  Fly   179 AENVRTEEIEVLNRMICDSA---YGNFLLRETVACAKEFKRSADCMFSAGCPVTAGDQLCGIVAW 240

  Fly   227 GYGCAYSNYPGVYADVAALRSWVI 250
            ...|..||.||::.|:..::.:::
  Fly   241 SPACKRSNLPGIFTDIHQVKRFIL 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 58/239 (24%)
CG34130NP_001036759.1 Trypsin 53..263 CDD:278516 55/234 (24%)
Tryp_SPc 53..256 CDD:304450 54/227 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.