DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and Jon99Ci

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_524555.1 Gene:Jon99Ci / 43545 FlyBaseID:FBgn0003358 Length:272 Species:Drosophila melanogaster


Alignment Length:273 Identity:77/273 - (28%)
Similarity:128/273 - (46%) Gaps:42/273 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKFVILLSAVACALGGTVPEGLL-PQ--------LDGRIVGGSATTISSFPW--QISLQRSGS-H 54
            |.|:.:.||:      |||..|: |:        ::|||..|:..:....|:  .:||..:|: .
  Fly     9 LAFLGVCSAL------TVPHSLVHPRDLEIRHGGIEGRITNGNLASEGQVPYIVGVSLNSNGNWW 67

  Fly    55 SCGGSIYSSNVIVTAAHCLQSVSASVLQIRAGSSYWSSGGVTFSVSS-----FKNHEGYNANTMV 114
            .|||||.....::|||||  :..|....:..|:..::......:|||     :.::.|.:     
  Fly    68 WCGGSIIGHTWVLTAAHC--TAGADEASLYYGAVNYNEPAFRHTVSSENFIRYPHYVGLD----- 125

  Fly   115 NDIAIIKINGALTFSSTIKAIGLAS----SNPANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIV 175
            :|:|:|| ...:.|.|.:..|.|.|    .|.........:|||.: |..|::...|:.|::.::
  Fly   126 HDLALIK-TPHVDFYSLVNKIELPSLDDRYNSYENNWVQAAGWGAI-YDGSNVVEDLRVVDLKVI 188

  Fly   176 SQSQCASSTYGYGSQIRSTMICAAASGKDACQGDSGGPLVS--GGVLVGVVSW--GYGCAYSNYP 236
            |.::| .:.||..:...:|:......||..||||||||||:  |..|:|:.|:  .|||.... |
  Fly   189 SVAEC-QAYYGTDTASENTICVETPDGKATCQGDSGGPLVTKEGDKLIGITSFVSAYGCQVGG-P 251

  Fly   237 GVYADVAALRSWV 249
            ..:..|.....|:
  Fly   252 AGFTRVTKYLEWI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 66/234 (28%)
Jon99CiNP_524555.1 Tryp_SPc 40..264 CDD:214473 66/234 (28%)
Tryp_SPc 41..266 CDD:238113 66/235 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.