DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and grass

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_651543.1 Gene:grass / 43273 FlyBaseID:FBgn0039494 Length:377 Species:Drosophila melanogaster


Alignment Length:259 Identity:76/259 - (29%)
Similarity:116/259 - (44%) Gaps:41/259 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LDGRIVGGSATTISSFPWQISL--QRSGSHS--CGGSIYSSNVIVTAAHCLQSVSASVLQIRAGS 87
            |..|:..|....:||.||...|  |:.|...  |||::.|...|:|||||:..:...:.:||.|.
  Fly   115 LSQRVSNGYEVKLSSRPWMALLRYQQFGESRFLCGGAMISERYILTAAHCVHGLQNDLYEIRLGE 179

  Fly    88 SYWSSGG---------------VTFSVSSFKNHEGYNANTMVNDIAIIKINGALTFSSTIKAIGL 137
            ...|:..               |...:.....||.|:|..:::|||::|:|.::.|...||.|.|
  Fly   180 HRISTEEDCRQQGRKKKCAPPVVNVGIEKHLIHEKYDARHIMHDIALLKLNRSVPFQKHIKPICL 244

  Fly   138 ASSNPANGAAASVS-----GWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTMIC 197
            ..::.....|..:|     ||||...||||  ..|...||.:..:|.|:.:   |...:..:.:|
  Fly   245 PITDELKEKAEQISTYFVTGWGTTENGSSS--DVLLQANVPLQPRSACSQA---YRRAVPLSQLC 304

  Fly   198 AAASG-KDACQGDSGGPLVSGG----------VLVGVVSWG-YGCAYSNYPGVYADVAALRSWV 249
            ..... :|:|:|||||||.:..          |..|:||.| ..|...:.||:|.:|.....|:
  Fly   305 VGGGDLQDSCKGDSGGPLQAPAQYLGEYAPKMVEFGIVSQGVVTCGQISLPGLYTNVGEYVQWI 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 74/254 (29%)
grassNP_651543.1 CLIP 32..90 CDD:197829
Tryp_SPc 121..371 CDD:238113 74/253 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.