DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and Tmprss9

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_006513905.2 Gene:Tmprss9 / 432478 MGIID:3612246 Length:1342 Species:Mus musculus


Alignment Length:273 Identity:93/273 - (34%)
Similarity:133/273 - (48%) Gaps:45/273 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 GTVPEGLLPQLDGRIVGGSATTISSFPWQISL-QRSGSHSCGGSIYSSNVIVTAAHCLQSVSASV 80
            |..|.|.|.    |||||||.::..:|||:|| .|...|.||..:.:...:::||||. .:....
Mouse  1075 GLAPPGALT----RIVGGSAASLGEWPWQVSLWLRRREHRCGAVLVAERWLLSAAHCF-DIYGDP 1134

  Fly    81 LQIRA--GSSYWSS-GGVTFSVSSFKNHEGYNANTMVNDIAIIKINGALTFSSTIKAIGL-ASSN 141
            :|..|  |:.:.|| .|....|:....|..||..|:..|:|::::.|.:..|..::.|.| ..:.
Mouse  1135 MQWAAFLGTPFLSSTEGQLERVARIYRHPFYNIYTLDYDVALLELAGPVRRSRLVRPICLPGPAR 1199

  Fly   142 PANGAAASVSGWGTLSYG-------------------------SSSIPSQLQYVNVNIVSQSQCA 181
            |.:||...::|||:|..|                         :.|:..|||...|.::|:..|.
Mouse  1200 PPDGARCVITGWGSLREGGIHACVRRSPGGVGDTPHLHLSPDPTGSMARQLQKAAVRVLSEQTCR 1264

  Fly   182 SSTYGYGSQIRSTMICAA--ASGKDACQGDSGGPLV----SG-GVLVGVVSWGYGCAYSNYPGVY 239
            ..   |..||.|.|:||.  ..|.|:|.||:||||.    || .||.||.||||||...::||||
Mouse  1265 RF---YPVQISSRMLCAGFPQGGVDSCSGDAGGPLACREPSGQWVLTGVTSWGYGCGRPHFPGVY 1326

  Fly   240 ADVAALRSWVISN 252
            ..|||:..|:..|
Mouse  1327 TRVAAVLGWIGQN 1339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 87/255 (34%)
Tmprss9XP_006513905.2 SEA 285..365 CDD:366610
LDLa 407..442 CDD:238060
Tryp_SPc 455..684 CDD:214473
Tryp_SPc 756..984 CDD:214473
Tryp_SPc 1085..1336 CDD:238113 86/254 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.