DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and CG31266

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster


Alignment Length:241 Identity:69/241 - (28%)
Similarity:113/241 - (46%) Gaps:30/241 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LPQLDGRIVGGSATTISSFPWQISLQRSGS-HSCGGSIYSSNVIVTAAHCLQSVSASVLQIRAGS 87
            :||  ||::||:.....::||..|:|.:.| |.||..|.....::|||.|:..:....|.:..|:
  Fly    47 VPQ--GRVIGGTTAAEGNWPWIASIQNAYSYHLCGAIILDETWVLTAASCVAGLRPLNLLVVTGT 109

  Fly    88 -SYWSSGGVTFSVSSFKNHEGYNANTMVNDIAIIKINGALTFSSTIKAIGLASSNP-ANGAAASV 150
             .:|......::||....|..::.....||||:::::..:.|:...|.|.||..:. ..|...:.
  Fly   110 VDWWDLYAPYYTVSQIHVHCNFDKPLYHNDIALLQLSSKIEFNDVTKNITLADIDELEEGDKLTF 174

  Fly   151 SGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTM----------ICAAA-SGKD 204
            :|||:    |.::.:..:|:        |.||.||......|..:          :|... :|:.
  Fly   175 AGWGS----SEAMGTYGRYL--------QEASGTYLPVDACREKLQNQDDVDLGHVCVQMDAGQG 227

  Fly   205 ACQGDSGGPLVSGGV-LVGVVSWGYGCAYSNYPGVYADVAALRSWV 249
            ||.||:||||:.... |||:.:||..|. ..||.|||..|....|:
  Fly   228 ACHGDTGGPLIDEQQRLVGIGNWGVPCG-RGYPDVYARTAFYHDWI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 65/233 (28%)
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 65/233 (28%)
Tryp_SPc 52..275 CDD:238113 65/234 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.