DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and CG17475

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster


Alignment Length:264 Identity:79/264 - (29%)
Similarity:117/264 - (44%) Gaps:21/264 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ILLSAVACALGGTVPEGLLPQL----------------DGRIVGGSATTISSFPWQISLQ-RSGS 53
            ||:..:||.....:....|.||                ..|::.|....:....:||||| ..|.
  Fly     9 ILVILLACTCYKPISAVRLAQLSEDQLEWISKAEGVNFQNRVINGEDVQLGEAKYQISLQGMYGG 73

  Fly    54 HSCGGSIYSSNVIVTAAHCLQSVSASVLQIRAGSSYWSSGGVTFSVSSFKNHEGYNANTMVNDIA 118
            |.|||.|.....::|||||:...:.:.|::..|:..:......:.|.....|..||:....||||
  Fly    74 HICGGCIIDERHVLTAAHCVYGYNPTYLRVITGTVEYEKPDAVYFVEEHWIHCNYNSPDYHNDIA 138

  Fly   119 IIKINGALTFSSTIKAIGLASSNPANGAAASVSGWG-TLSYGSSSIPSQLQYVNVNIVSQSQCAS 182
            :|::|..:.|:...:...|.::..|||....::||| |..:|.:  |..||...:..|..|.|..
  Fly   139 LIRLNDTIKFNEYTQPAELPTAPVANGTQLLLTGWGSTELWGDT--PDILQKAYLTHVVYSTCQE 201

  Fly   183 STYGYGSQIRSTMICAAASGKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYADVAALRS 247
            ......|.....:......|:.||.|||||||...|||.|:|:|||.||. ..|..:|:|.....
  Fly   202 IMNNDPSNGPCHICTLTTGGQGACHGDSGGPLTHNGVLYGLVNWGYPCAL-GVPDSHANVYYYLE 265

  Fly   248 WVIS 251
            |:.|
  Fly   266 WIRS 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 70/220 (32%)
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 70/220 (32%)
Tryp_SPc 50..269 CDD:238113 70/221 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.