DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and ea

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_524362.2 Gene:ea / 41858 FlyBaseID:FBgn0000533 Length:392 Species:Drosophila melanogaster


Alignment Length:284 Identity:76/284 - (26%)
Similarity:115/284 - (40%) Gaps:82/284 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LDGRIVGGSATTISSFPWQISLQRSGS-----HSCGGSIYSSNVIVTAAHCLQSVSASVLQIRAG 86
            |..||.||..|.|..|||...::.:.|     |.||||:.|:..::||:||:..        :|.
  Fly   124 LSNRIYGGMKTKIDEFPWMALIEYTKSQGKKGHHCGGSLISTRYVITASHCVNG--------KAL 180

  Fly    87 SSYWSSGGVTF-------------SVSSFKN---------------HEGY--NANTMVNDIAIIK 121
            .:.|...||..             .|...|:               |..|  .:...|||||:::
  Fly   181 PTDWRLSGVRLGEWDTNTNPDCEVDVRGMKDCAPPHLDVPVERTIPHPDYIPASKNQVNDIALLR 245

  Fly   122 INGALTFSSTIKAIGL-----ASSNPANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVS----- 176
            :...:.::..::.|.|     ..|...:|....|:|||.        ..||...|:.:.:     
  Fly   246 LAQQVEYTDFVRPICLPLDVNLRSATFDGITMDVAGWGK--------TEQLSASNLKLKAAVEGF 302

  Fly   177 -QSQCASSTYGYGSQ---IRSTMICAAA-SGKDACQGDSGGPLVSGGV----------LVGVVSW 226
             ..:|.:.   |.||   :..|.:||.. .|.|:|:|||||||:  |:          |.||||:
  Fly   303 RMDECQNV---YSSQDILLEDTQMCAGGKEGVDSCRGDSGGPLI--GLDTNKVNTYYFLAGVVSF 362

  Fly   227 G-YGCAYSNYPGVYADVAALRSWV 249
            | ..|..:.:||||..|.....|:
  Fly   363 GPTPCGLAGWPGVYTLVGKYVDWI 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 74/279 (27%)
eaNP_524362.2 CLIP 37..89 CDD:288855
Tryp_SPc 127..386 CDD:214473 74/279 (27%)
Tryp_SPc 128..389 CDD:238113 74/280 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.