DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and CG3505

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_650380.2 Gene:CG3505 / 41777 FlyBaseID:FBgn0038250 Length:360 Species:Drosophila melanogaster


Alignment Length:276 Identity:70/276 - (25%)
Similarity:119/276 - (43%) Gaps:53/276 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 GTVPEGLLPQLDGRI----VGGSATTISSFPWQISLQ-----RSGSHSCGGSIYSSNVIVTAAHC 72
            |.:...|||...|::    ...:.|.|..|||...::     :...|:|||.:.|...::|||||
  Fly    89 GALTHPLLPSDCGKVRWQRSNDTDTRIREFPWLALIEYTRGNQEKIHACGGVLISDRYVLTAAHC 153

  Fly    73 LQSVSASVLQIRA------------GSSYWSSGGVT--------FSVSSFKNHEGYNA--NTMVN 115
            :...:.|.|||.|            ...|.....|.        .::.....|..||.  .|.:|
  Fly   154 VAQAATSNLQITAVRLGEWDTSTNPDCQYHEDSKVADCAPPYQDIAIEELLPHPLYNRTDRTQIN 218

  Fly   116 DIAIIKINGALTFSSTIKAIGLAS----SNPANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVS 176
            |||::::......:..::.|.|.:    ::........|:||    ..|||...:..||.::.:.
  Fly   219 DIALVRLASPAKLNDFVQPICLPNKQLRADELEDLVTEVAGW----QASSSQRMRKGYVTISSIE 279

  Fly   177 QSQCASSTYGYGSQ---IRSTMICAAASGKDACQGDSGGPLV----SGGVLVGVVSWG-YGCAYS 233
            :.|     ..|.||   |:::.:|...:.:: |.|::||||:    .|.:|.|:||:| ..|...
  Fly   280 ECQ-----RKYASQQLRIQASKLCGLTNSQE-CYGNAGGPLMLFKNDGYLLGGLVSFGPVPCPNP 338

  Fly   234 NYPGVYADVAALRSWV 249
            ::|.||..||:...|:
  Fly   339 DWPDVYTRVASYIDWI 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 64/261 (25%)
CG3505NP_650380.2 CLIP 30..82 CDD:288855
Tryp_SPc 111..356 CDD:238113 65/254 (26%)
Tryp_SPc 111..354 CDD:214473 64/252 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.