DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and CG8870

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_731802.1 Gene:CG8870 / 41645 FlyBaseID:FBgn0038144 Length:356 Species:Drosophila melanogaster


Alignment Length:261 Identity:63/261 - (24%)
Similarity:103/261 - (39%) Gaps:51/261 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 GSATTISSFPWQISLQRSGSHS--------CGGSIYSSNVIVTAAHCLQ----SVSASVLQIRAG 86
            |....::.|||...|.....::        ||||:.::..::|||||::    ....::..:|.|
  Fly    87 GKIPALNEFPWMAMLLYGNKNNLSQKLVPKCGGSLINNWYVLTAAHCVEYPFMDYPYALKTVRLG 151

  Fly    87 SSYWSSGG---------------VTFSVSSFKNHEGYN-ANTMVNDIAIIKINGALTFSSTIKAI 135
            ....|:..               :...|.....||.:| ...::||||::::...:.::..|:.|
  Fly   152 EHNTSTNPDRAIVNGRRQYAPLYMEIEVDQIITHEQFNRGRRLINDIALVRLKFPVRYTRAIQPI 216

  Fly   136 GL--ASSNPANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGY--GSQIRSTMI 196
            .|  |....|:......|||..:..|   |.|::...:...........|.|.:  |||     |
  Fly   217 CLPRAQKLAAHKRKFQASGWPDMGQG---IASEVLLRSFIAERHPDVCKSNYDFNLGSQ-----I 273

  Fly   197 CAAA-SGKDACQGDSGGPL----VSGGVLV----GVVSWGY-GCAYSN-YPGVYADVAALRSWVI 250
            ||.. .|.|...|||||||    :.|.|.:    |::|:|. .|.... .|..|...:....|:.
  Fly   274 CAGGLDGNDTSPGDSGGPLMETVIRGKVTLTYAAGIISYGQKPCVLKTCKPAFYTKTSYFFEWIK 338

  Fly   251 S 251
            |
  Fly   339 S 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 61/257 (24%)
CG8870NP_731802.1 Tryp_SPc 93..340 CDD:238113 62/255 (24%)
Tryp_SPc 93..337 CDD:214473 60/251 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.