DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and CG13318

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_649831.1 Gene:CG13318 / 41048 FlyBaseID:FBgn0037627 Length:405 Species:Drosophila melanogaster


Alignment Length:268 Identity:75/268 - (27%)
Similarity:133/268 - (49%) Gaps:38/268 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VACALGGTV--------PEGLLPQLDGRIVGGSATTISSFPWQISLQRSGS-HSCGGSIYSSNVI 66
            |||...|:.        |.|......|:      .:..::|||.:|..:.. :..||::.::..:
  Fly   141 VACCQAGSYQCGRRFPPPPGSTTAAPGQ------ASFGAYPWQAALLTTADVYLGGGALITAQHV 199

  Fly    67 VTAAHCLQSVSASVLQIRAGSSYWSSGGVT-------FSVSSFKNHEGYNANTMVNDIAIIKING 124
            :||||.:.::..:..::|.|.  |.:...:       ..:|:...:..:|.|.:.||:||:|::.
  Fly   200 LTAAHKVYNLGLTYFKVRLGE--WDAASTSEPIPAQDVYISNVYVNPSFNPNNLQNDVAILKLST 262

  Fly   125 --ALTFSSTIKAIGLASSNPANGAAASVSGWGTLSYGSSSIPSQLQ-YVNVNIVSQSQCASSTYG 186
              :||..||:..:.|.:::.. |....|:|||...:|::.....:: .|:|.::..:.|.::...
  Fly   263 PVSLTSKSTVGTVCLPTTSFV-GQRCWVAGWGKNDFGATGAYQAIERQVDVPLIPNANCQAALQA 326

  Fly   187 --YGSQI---RSTMICAAA-SGKDACQGDSGGPLV--SGGV--LVGVVSWGYGCAYSNYPGVYAD 241
              .||..   .::.|||.. :|||||.||.|.|||  |.||  :||:|:||.|||.:..||||.:
  Fly   327 TRLGSSFVLSPTSFICAGGEAGKDACTGDGGSPLVCTSNGVWYVVGLVAWGIGCAQAGVPGVYVN 391

  Fly   242 VAALRSWV 249
            |.....|:
  Fly   392 VGTYLPWI 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 67/239 (28%)
CG13318NP_649831.1 Tryp_SPc 169..402 CDD:238113 68/234 (29%)
Tryp_SPc 169..399 CDD:214473 67/232 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.