DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and Prss57

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_038935644.1 Gene:Prss57 / 408241 RGDID:1303330 Length:290 Species:Rattus norvegicus


Alignment Length:229 Identity:69/229 - (30%)
Similarity:107/229 - (46%) Gaps:14/229 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 IVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTAAHCLQSVSASVLQIRAGSSYWSSGGV 95
            ||||......:.|:..|:...|.|.|||.::.::.:::||||......|...:..|:....:...
  Rat    46 IVGGHEVKPHARPYMASVNFEGHHHCGGFLFHAHWVLSAAHCFSDRDPSTGLVVLGAHALLTPEP 110

  Fly    96 T---FSVSSFKNHEGYNANTMVNDIAIIKINGALTFSSTIKAIGL---ASSNPANGAAASVSGWG 154
            |   |.:::..:|..:...|..|||.::::||:......::.:.|   .:..|..|....|||||
  Rat   111 TQQVFGIAAVVSHPDFEPTTQANDICLLRLNGSAVLGPAVRLLRLPRRGAKPPVAGTRCRVSGWG 175

  Fly   155 TLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTMICAAASG---KDACQGDSGGPLVS 216
            ::| .....|..|..|.|.|:..|.|.||..|   |:...|:|..:..   :..|..|||||||.
  Rat   176 SVS-DFEEPPPGLMEVEVRILDLSVCNSSWQG---QLSPAMLCTHSGDRRRRGFCSADSGGPLVC 236

  Fly   217 GGVLVGVVSW-GYGCAYSNYPGVYADVAALRSWV 249
            |....|:||: |..|.....|.||..|:|..||:
  Rat   237 GNRAHGLVSFSGLWCGDPKTPDVYTQVSAFVSWI 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 68/227 (30%)
Prss57XP_038935644.1 Tryp_SPc 46..270 CDD:238113 68/227 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.