DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and Mcpt8l2

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001128482.1 Gene:Mcpt8l2 / 408240 RGDID:1302938 Length:248 Species:Rattus norvegicus


Alignment Length:266 Identity:72/266 - (27%)
Similarity:117/266 - (43%) Gaps:45/266 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKFVILLSAVACALGGTVP---EGLLPQLDGRIVGGSATTISSFPWQISLQ----RSGSHSCGG 58
            |..|:..|.||       :|   ||      |.|:.|:.:...|.|:...::    .|...||||
  Rat     1 MFLFLFFLVAV-------LPVNTEG------GEIIWGTESKPHSRPYMAFIKFYDSNSEPQSCGG 52

  Fly    59 SIYSSNVIVTAAHC-----LQSVSASVLQIRAGSSYWSSGGVTFSVSSFKNHEGYNANTMVNDIA 118
            .:.:.::::|||||     ..::.|..::.|..:.       ..||...|.||.|:.::..|||.
  Rat    53 FLVAKDIVMTAAHCNGRNIKVTLGAHNIRKRENTQ-------VISVVKAKPHENYDKHSRFNDIM 110

  Fly   119 IIKINGALTFSSTIKAIGLASSNP--ANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCA 181
            ::|:......:..:|.|.|..|..  ..|...:|:|||.|:..:||  :.||.||:.:....:|.
  Rat   111 LLKLERKAQLNGAVKTIALPRSQDWVKPGQVCTVAGWGHLANCTSS--NTLQEVNLEVQKGQKCQ 173

  Fly   182 SSTYGYGSQIRSTMICAA--ASGKDACQGDSGGPLVSGGVLVGVVSWGYGC-AYSNYPGVYADVA 243
            ..:..|...|:   :|..  ..||...:.|||||.|..||..|:||   .| .....|.|:..::
  Rat   174 DMSKDYNDSIQ---LCVGNPKEGKATSERDSGGPFVCDGVAQGIVS---RCLCTGTLPRVFTRIS 232

  Fly   244 ALRSWV 249
            :...|:
  Rat   233 SFIPWI 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 62/232 (27%)
Mcpt8l2NP_001128482.1 Tryp_SPc 20..238 CDD:214473 62/232 (27%)
Tryp_SPc 21..241 CDD:238113 63/233 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.