DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and CG11037

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_649272.1 Gene:CG11037 / 40317 FlyBaseID:FBgn0037038 Length:292 Species:Drosophila melanogaster


Alignment Length:223 Identity:76/223 - (34%)
Similarity:118/223 - (52%) Gaps:5/223 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RIVGGSATTISSF-PWQISLQRSGSHSCGGSIYSSNVIVTAAHC-LQSVSASVLQIRAGSSYWSS 92
            |::||..||.:.. .:..:|.......|||::.:.|:::||||| |..:.||...:.||.|..:.
  Fly    61 RVIGGHVTTNAKLGGYLTALLYEDDFVCGGTLLNENIVLTAAHCFLGRMKASEWIVAAGISNLNQ 125

  Fly    93 GGVTFSVSSFKNHEGYNANTMVNDIAIIKINGALTFSSTIKAIGLASSNPANGAAASVSGWGTLS 157
            .|:...|..|...|.:..:.|..|:|::.:...|. :..|..:.|.|.:...|....|||||..:
  Fly   126 KGIRRHVKDFILSEQFREDDMNMDVAVVLLKTPLK-AKNIGTLSLCSVSLKPGVELVVSGWGMTA 189

  Fly   158 YGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTMICAAASG-KDACQGDSGGPLVSGGVLV 221
            .......:.|:.|.|.|:.:..|.:: |...::|..:|||||..| ||||..|||||||....:.
  Fly   190 PRGRGPHNLLRTVTVPIIHKKNCRAA-YQPTAKITDSMICAAVLGRKDACTFDSGGPLVFKKQVC 253

  Fly   222 GVVSWGYGCAYSNYPGVYADVAALRSWV 249
            |:||:|.|||.:.|||||.||..::.::
  Fly   254 GIVSFGIGCASNRYPGVYTDVMYVKPFI 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 76/221 (34%)
CG11037NP_649272.1 Tryp_SPc 61..281 CDD:214473 76/221 (34%)
Tryp_SPc 62..283 CDD:238113 75/222 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.