DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and CG7542

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster


Alignment Length:271 Identity:86/271 - (31%)
Similarity:130/271 - (47%) Gaps:33/271 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLSAVACAL--GGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRS-GSHS--CGGSIYSSNVI 66
            ::..:.|.|  |......||..::..|..|....:..||:|..|..| |:.|  |||::.|...|
  Fly     1 MMKLLVCVLLVGSCTAVPLLTDVEPYITNGEPAEVGQFPYQAGLNVSFGNWSTWCGGTLISHYWI 65

  Fly    67 VTAAHCL---QSVSASVLQIRAGSSYWSSGG---VTFSVSSFKNHEGYNANTMVNDIAIIKINGA 125
            :|||||:   :||:..:..|..|..  |..|   :....|....|..|.|:|:||||::|::...
  Fly    66 ITAAHCMDGAESVTVYLGAINIGDE--SEEGQERIMVEKSGIIVHSNYMASTVVNDISLIRLPAF 128

  Fly   126 LTFSSTIKAIGLASSNPANG-------AAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASS 183
            :.|:..|:|..|  ....||       ..|..||||..|..|.|:...|:||.:.|:..|.|  .
  Fly   129 VGFTDRIRAASL--PRRLNGQFPTYESIRAFASGWGRESDASDSVSPVLRYVEMPIMPHSLC--R 189

  Fly   184 TYGYGSQIRSTMIC-AAASGKDACQGDSGGPLV----SGGVLVGVVSWG--YGCAYSNYPGVYAD 241
            .|..|: :...||| :..|||..|.||||||||    :...|:|..|:|  .||.. .:|.|:..
  Fly   190 MYWSGA-VSEKMICMSTTSGKSTCHGDSGGPLVYKQGNSSYLIGSTSFGTSMGCQV-GFPAVFTR 252

  Fly   242 VAALRSWVISN 252
            :::...|::::
  Fly   253 ISSYLDWILNH 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 80/241 (33%)
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 81/243 (33%)
Tryp_SPc 27..260 CDD:214473 80/240 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.