DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and CG4914

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_648711.1 Gene:CG4914 / 39597 FlyBaseID:FBgn0036436 Length:374 Species:Drosophila melanogaster


Alignment Length:244 Identity:77/244 - (31%)
Similarity:120/244 - (49%) Gaps:22/244 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 DGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTAAHCLQSVSASVLQIRAGS----S 88
            :.|||||:.|.:|.:||...|.......|||::.:...::|||||::.....::::..|.    :
  Fly   125 ESRIVGGTTTGVSEYPWMARLSYFNRFYCGGTLINDRYVLTAAHCVKGFMWFMIKVTFGEHDRCN 189

  Fly    89 YWSSGGVTFSVSSFKNHEGYNANTMVNDIAIIKINGALTFSSTIKAIGLASSNPAN----GAAAS 149
            ........|.:.:|.  :.::.:...||||::::|..:..:|.|:.|.|.......    |..|.
  Fly   190 DKERPETRFVLRAFS--QKFSFSNFDNDIALLRLNDRVPITSFIRPICLPRVEQRQDLFVGTKAI 252

  Fly   150 VSGWGTLSYGSSSIPS-QLQYVNVNIVSQSQCASSTYGYGSQIRSTMICA---AASGKDACQGDS 210
            .:|||||.  ....|| .||.|.|.::...:|.:.|......|...|:|:   ...|:|:|||||
  Fly   253 ATGWGTLK--EDGKPSCLLQEVEVPVLDNDECVAQTNYTQKMITKNMMCSGYPGVGGRDSCQGDS 315

  Fly   211 GGPLV------SGGVLVGVVSWGYGCAYSNYPGVYADVAALRSWVISNA 253
            |||||      .....:|:||||.|||..||||||..|.....|::.|:
  Fly   316 GGPLVRLRPDDKRFEQIGIVSWGNGCARPNYPGVYTRVTKYLDWIVENS 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 75/236 (32%)
CG4914NP_648711.1 Tryp_SPc 127..360 CDD:214473 75/236 (32%)
Tryp_SPc 128..363 CDD:238113 75/238 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.