DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and cfd

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_989320.1 Gene:cfd / 394945 XenbaseID:XB-GENE-973605 Length:265 Species:Xenopus tropicalis


Alignment Length:230 Identity:70/230 - (30%)
Similarity:119/230 - (51%) Gaps:8/230 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 GRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTAAHCLQSVSASVLQIRAGSSYWSSG 93
            |||:||..:.....|:..|:|::|.|.|||.:.:...:::||||..:.|.|.|.:..|:...|..
 Frog    25 GRILGGQDSKAEVRPYMASIQQNGIHQCGGVLIADKWVLSAAHCATNSSNSSLNVMLGAISLSKP 89

  Fly    94 ---GVTFSVSSFKNHEGYNANTMVNDIAIIKINGALTFSSTIKAIGLASSN--PANGAAASVSGW 153
               .:...|.....|..||:....:|:.:::::..:|.|..:..:...:.|  .:.|....|:||
 Frog    90 EKYKIVVKVLREIPHPLYNSTIKHHDLLLLELSEKVTLSPAVNPLPFQNENIDISAGKRCLVAGW 154

  Fly   154 GTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTMICAAASGKDACQGDSGGPLVSGG 218
            |.:.. :...|..||.:.|.::|:..|....| |.::|.:.||||..|.||:|:||||||||..|
 Frog   155 GQMRL-TGKKPDTLQELWVPLISRDVCNRRNY-YDNEITANMICAGESRKDSCEGDSGGPLVCDG 217

  Fly   219 VLVGVVSWGY-GCAYSNYPGVYADVAALRSWVISN 252
            :.|.:|..|: .|.....||:|..:...:||::.:
 Frog   218 IAVAIVQGGFRKCGNPTKPGIYTLIEPYKSWIMES 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 68/224 (30%)
cfdNP_989320.1 Tryp_SPc 27..251 CDD:238113 68/225 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.