DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and CG18180

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_648341.1 Gene:CG18180 / 39125 FlyBaseID:FBgn0036024 Length:264 Species:Drosophila melanogaster


Alignment Length:269 Identity:87/269 - (32%)
Similarity:130/269 - (48%) Gaps:33/269 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKFVILLSAVACALGGTVPEG-----LLPQ-LDGRIVGGSATTISSFPWQISL--QRSGSHS-- 55
            |..|::.||| |.||....|.|     ||.| .:||||.|........|:.:.|  :..||:|  
  Fly     1 MKLFLLTLSA-ALALVAASPTGLNRTTLLSQGAEGRIVNGYPAPEGKAPYIVGLFIRTDGSNSGA 64

  Fly    56 -CGGSIYSSNVIVTAAHCLQSVSASVLQIRAGSSYWSSGGVTFSV--SSFKNHEGYNANTMVNDI 117
             ..|:|.:::.|:||||||   :...::|..||::..:|....:|  .:|.:|..:.:.. ..||
  Fly    65 VGAGTIIANDWILTAAHCL---TGDYVEIHYGSNWGWNGAYRQTVRRDNFISHPDWPSQG-GRDI 125

  Fly   118 AIIKINGALTFSSTIKAIGLASSNPANGAAAS----VSGWGTLSYGSSSIPSQLQYVNVNIVSQS 178
            .:|: ...:.|:..|..|.|.|.|..|.....    ..|||.:..|  ::...||.|:|.|:|.|
  Fly   126 GLIR-TPHVDFNGLINKIPLPSMNEQNDRYQDTWCVACGWGGMDNG--NLADWLQCVDVQIISNS 187

  Fly   179 QCASSTYGYGSQIRSTMICAA-ASGKDACQGDSGGPLVS--GGVLVGVVSWGYGCAYSNYPGVYA 240
            :|..:   ||| :.||.:|.. |.||..|.||||||||:  ...||||:::.....:.. |..|.
  Fly   188 ECEQA---YGS-VASTDMCTRHADGKSVCGGDSGGPLVTHDNARLVGVITFASVSCHDG-PSGYT 247

  Fly   241 DVAALRSWV 249
            .|:....|:
  Fly   248 RVSDYLEWI 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 72/232 (31%)
CG18180NP_648341.1 Tryp_SPc 35..256 CDD:214473 72/232 (31%)
Tryp_SPc 36..259 CDD:238113 72/233 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.