DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and TMPRSS11F

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_997290.2 Gene:TMPRSS11F / 389208 HGNCID:29994 Length:438 Species:Homo sapiens


Alignment Length:249 Identity:82/249 - (32%)
Similarity:119/249 - (47%) Gaps:46/249 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RIVGGSATTI-SSFPWQISLQRSGS-HSCGGSIYSSNVIVTAAHCLQSVSASVLQIRAGSSYWSS 92
            |||.|..|.: ..:|||.|||..|| |.||.|:.|:..::|||||                :|.:
Human   205 RIVQGRETAMEGEWPWQASLQLIGSGHQCGASLISNTWLLTAAHC----------------FWKN 253

  Fly    93 GGVTFSVSSF----------KN------HEGYNANTMVNDIAIIKINGALTFSSTIKAIGLASSN 141
            ...|..:::|          :|      ||.|:..|..||||:::::..:.||:.::.:.|..|:
Human   254 KDPTQWIATFGATITPPAVKRNVRKIILHENYHRETNENDIALVQLSTGVEFSNIVQRVCLPDSS 318

  Fly   142 ---PANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTMICAA-ASG 202
               |.. .:..|:|:|:: .....|.:.|:...|..:|...|..... |...|...|:||. ..|
Human   319 IKLPPK-TSVFVTGFGSI-VDDGPIQNTLRQARVETISTDVCNRKDV-YDGLITPGMLCAGFMEG 380

  Fly   203 K-DACQGDSGGPLVSGG----VLVGVVSWGYGCAYSNYPGVYADVAALRSWVIS 251
            | |||:||||||||...    .:||:||||..||....||||..|...|.|:.|
Human   381 KIDACKGDSGGPLVYDNHDIWYIVGIVSWGQSCALPKKPGVYTRVTKYRDWIAS 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 80/245 (33%)
TMPRSS11FNP_997290.2 SEA 59..154 CDD:279699
Tryp_SPc 205..432 CDD:214473 80/245 (33%)
Tryp_SPc 206..435 CDD:238113 81/248 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.