DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and CG10469

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster


Alignment Length:251 Identity:77/251 - (30%)
Similarity:118/251 - (47%) Gaps:45/251 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RIVGGSATTISSFPWQISL------QRSGSHSCGGSIYSSNVIVTAAHCLQSVSASV--LQIRAG 86
            ||:.|:|......|:|:.|      .:...:.|||:|.|:..|:|||||||...:::  :.|..|
  Fly    23 RIMNGTAAKAKQLPYQVGLLCYFEGSKDEPNMCGGTILSNRWIITAAHCLQDPKSNLWKVLIHVG 87

  Fly    87 SSYWSSGGVTFSVSSFKN------------HEGYNANTMVNDIAIIKINGALTFSSTIKAIGLAS 139
                       .|.||.:            |:.::..|:.||||:||:...|||:..|:...|.|
  Fly    88 -----------KVKSFDDKEIVVNRSYTIVHKKFDRKTVTNDIALIKLPKKLTFNKYIQPAKLPS 141

  Fly   140 SNPA-NGAAASVSGWGTLSYGSSSIPSQ-LQYVNVNIVSQSQCA---SSTYGYGSQ--IRSTMIC 197
            :... .|..|.:||||..   :..:||| |||:...|:|..:|.   :...|..|:  :.:..||
  Fly   142 AKKTYTGRKAIISGWGLT---TKQLPSQVLQYIRAPIISNKECERQWNKQLGGKSKKVVHNGFIC 203

  Fly   198 AAASGKDACQGDSGGPLV---SGGVLVGVVSWGY-GCAYSNYPGVYADVAALRSWV 249
            ..:.....|:||||||:|   ....|||:||.|: |......|.|...|::...|:
  Fly   204 IDSKKGLPCRGDSGGPMVLDDGSRTLVGIVSHGFDGECKLKLPDVSTRVSSYLKWI 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 76/249 (31%)
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 76/249 (31%)
Tryp_SPc 24..260 CDD:238113 76/250 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.