DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and Jon65Aiv

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_648012.1 Gene:Jon65Aiv / 38682 FlyBaseID:FBgn0250815 Length:271 Species:Drosophila melanogaster


Alignment Length:273 Identity:97/273 - (35%)
Similarity:144/273 - (52%) Gaps:27/273 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKFVILLSAVACALGGTVPE--------GLLPQLDGRIVGGSATTISSFPWQI--SLQRSGSHS- 55
            :||:|:|:....|.....||        .::..:.|||.|||...:..||:|:  ||:.|...| 
  Fly     1 MKFLIILALAVAASAFPEPELRHRSREMPVVGDIGGRITGGSNAAVGQFPYQVGLSLKLSALSSA 65

  Fly    56 -CGGSIYSSNVIVTAAHCLQSVSASVLQIRAGSSYWSSGGVTFSVSS--FKNHEGYNANTMVNDI 117
             ||||:..|..::|||||...|.:  :.:..|::..:|..:|.:|||  ...|.|:|:..:.|||
  Fly    66 WCGGSLIGSTWVLTAAHCTDGVQS--VTVYLGATVRTSAEITHTVSSSDIIIHSGWNSANLRNDI 128

  Fly   118 AIIKINGALTFSSTIKAIGLAS-SNPAN---GAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQS 178
            ::||| .|.:.||.|.|:.|.| ||..:   |..|..||||..|..||.:.:.||||::.:::.:
  Fly   129 SLIKI-PATSSSSRISAVKLPSISNSYSTFVGDVAVASGWGRTSDTSSGVATNLQYVDLTVITNT 192

  Fly   179 QCASSTYGYGSQIRSTMICAAASGKDACQGDSGGPLV--SGGVLVGVVSWG--YGCAYSNYPGVY 239
            :|| .|||......||:..|....|..|.||||||||  |....:|:.|:|  .||. ..||..:
  Fly   193 KCA-QTYGTSVVTDSTLCVATTDAKSTCNGDSGGPLVLKSSSEQIGLTSFGASAGCE-KGYPAAF 255

  Fly   240 ADVAALRSWVISN 252
            ..|.:...|:.:|
  Fly   256 TRVTSYLDWIKTN 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 87/232 (38%)
Jon65AivNP_648012.1 Tryp_SPc 37..265 CDD:214473 87/232 (38%)
Tryp_SPc 38..268 CDD:238113 87/234 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.