DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and CG10477

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster


Alignment Length:275 Identity:95/275 - (34%)
Similarity:140/275 - (50%) Gaps:37/275 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKFVILLSAVACALGGTVPEGLL--------------PQLDGRIVGGSATTISSFPWQISL--- 48
            |..|.:|:.|:|     ||...:|              |.:||||..|:....:.||:|:.|   
  Fly     1 MKVFAVLVLAIA-----TVSADILRQDTPVHPRDSSAVPSIDGRITNGNKAAANQFPYQVGLSFK 60

  Fly    49 QRSGSHSCGGSIYSSNVIVTAAHCLQSVSASVLQIRAGSSYWSSGGVTFSVSS--FKNHEGYNAN 111
            ..:||..|||||.::..::|||||.:  .||.:.|..||:..:|..:...|||  |..|.||||.
  Fly    61 SSAGSWWCGGSIIANTWVLTAAHCTK--GASSVTIYYGSTVRTSAKLKKKVSSSKFVQHAGYNAA 123

  Fly   112 TMVNDIAIIKINGALTFSSTIKAIGL----ASSNPANGAAASVSGWGTLSYGSSSIPSQLQYVNV 172
            |:.|||::|| ..::||:.:|..|.|    :|.:...|..|..||||..|..|.::.:.|||...
  Fly   124 TLRNDISLIK-TPSVTFTVSINKIALPAIASSYSTYAGQTAVASGWGRTSDSSIAVATNLQYAQF 187

  Fly   173 NIVSQSQCASSTYGYGSQIRSTMICA-AASGKDACQGDSGGPLVSGGVLVGVVSW--GYGCAYSN 234
            .:::.:.| ..|:| .|.:.|.:||. :.:.|..|||||||||.....|:||.|:  ..||. .|
  Fly   188 QVITNAVC-QKTFG-SSVVTSGVICVESINKKSTCQGDSGGPLALNNRLIGVTSFVSSKGCE-KN 249

  Fly   235 YPGVYADVAALRSWV 249
            .|..:..|.:...|:
  Fly   250 APAGFTRVTSYLDWI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 83/230 (36%)
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 83/230 (36%)
Tryp_SPc 40..267 CDD:238113 83/231 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.