DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and mas

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_523919.1 Gene:mas / 38499 FlyBaseID:FBgn0011653 Length:1047 Species:Drosophila melanogaster


Alignment Length:254 Identity:77/254 - (30%)
Similarity:124/254 - (48%) Gaps:31/254 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 GLLPQLDG----RIVGGSATTISSFPWQISLQRS-GSHSCGGSIYSSNVIVTAAHCLQSV--SAS 79
            ||.....|    |:|||.......:.||::|..| ..:.||.::..:..::|||||:.::  |..
  Fly   790 GLQSNFSGRRRARVVGGEDGENGEWCWQVALINSLNQYLCGAALIGTQWVLTAAHCVTNIVRSGD 854

  Fly    80 VLQIRAGS-----SYWSSGGVTFSVSSFKNHEGYNANTMVNDIAIIKINGALTFSSTIKAIGLAS 139
            .:.:|.|.     .|.|.|..|..|::...|..:|:.|:.||||::|::|.......:..:.|  
  Fly   855 AIYVRVGDYDLTRKYGSPGAQTLRVATTYIHHNHNSQTLDNDIALLKLHGQAELRDGVCLVCL-- 917

  Fly   140 SNPANGAA------ASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQI---RSTM 195
              ||.|.:      .:|:|:|.:. .:..||.:::...:.|||.::|.........:|   .::.
  Fly   918 --PARGVSHAAGKRCTVTGYGYMG-EAGPIPLRVREAEIPIVSDTECIRKVNAVTEKIFILPASS 979

  Fly   196 ICAAA-SGKDACQGDSGGPLV--SGGV--LVGVVSWGYGCAYSNYPGVYADVAALRSWV 249
            .||.. .|.||||||.|||||  ..|.  |.|:||||:||...:.||||...::...|:
  Fly   980 FCAGGEEGHDACQGDGGGPLVCQDDGFYELAGLVSWGFGCGRQDVPGVYVKTSSFIGWI 1038

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 73/240 (30%)
masNP_523919.1 Tryp_SPc 803..1041 CDD:238113 73/241 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.