DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and CG32277

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_728835.1 Gene:CG32277 / 38393 FlyBaseID:FBgn0052277 Length:261 Species:Drosophila melanogaster


Alignment Length:276 Identity:79/276 - (28%)
Similarity:125/276 - (45%) Gaps:57/276 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ILLSAVACALGGTVPEGLLPQLD---------GRIVGGSATTISSFPWQISLQRSGSHSCGGSIY 61
            |||..:|          ||.||:         |:|.||..|.:....:.::|:|.|...|||.|.
  Fly     3 ILLIGLA----------LLHQLEGSSLFTLRQGKIFGGKTTLVKDHSFLVNLRRGGKFRCGGVII 57

  Fly    62 SSNVIVTAAHCLQSVSASV--LQIRAGS-------------SYWSSGGVTFSVSSFKNHEGYNAN 111
            |.|.::||||||:.....|  |.:.|..             |.|              :.|.:.|
  Fly    58 SPNCVLTAAHCLEGRYQQVRDLTVHAQQQCLGDDMPPEHVRSAW--------------YVGLSPN 108

  Fly   112 -----TMVNDIAIIKINGALTFSSTIKAIGLASSNPANGAAASVSGWGTLSYGSSSIPSQLQYVN 171
                 .:.:|:|:|:::.....:.....:.:..::....:..:|.|||.::....:....||..|
  Fly   109 YCAQRGLDSDLAVIRLSRPFDIAGNASLVKIDYNDLPPHSNLTVLGWGAINEQGHNWNQCLQEAN 173

  Fly   172 VNIVSQSQCASSTYGYGSQIRSTMICA-AASGKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNY 235
            |.::|..:|..|......::.:.|.|| ..:.:||||||||||.:..|..||:|||||||. |.|
  Fly   174 VKLISHRECIKSVGSGWQKVTNNMFCALGKNARDACQGDSGGPAIYAGRSVGIVSWGYGCG-SGY 237

  Fly   236 PGVYADVA--ALRSWV 249
            ||||..::  ::..|:
  Fly   238 PGVYTRLSSPSITYWL 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 69/241 (29%)
CG32277NP_728835.1 Tryp_SPc 26..246 CDD:214473 69/234 (29%)
Tryp_SPc 27..246 CDD:238113 69/233 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.