DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and CG32271

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_728833.1 Gene:CG32271 / 38392 FlyBaseID:FBgn0052271 Length:248 Species:Drosophila melanogaster


Alignment Length:225 Identity:81/225 - (36%)
Similarity:132/225 - (58%) Gaps:3/225 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 QLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTAAHCLQSVSASVLQIRAGSSYW 90
            :.:.|||||....|:|.|:.::|:..|:..||||:.:...:||||||::.:.||.:.:.||.:..
  Fly    20 EANSRIVGGVPVDIASVPYLVNLRIGGNFMCGGSLVTPQHVVTAAHCVKGIGASRILVVAGVTRL 84

  Fly    91 SSGGVTFSVSSFKNHEGYNANTMVNDIAIIKINGALTFSSTIKAIGLASSNPANGAAASVSGWGT 155
            :..||...|......:.||..|:.:|:|::|:...:: ...:..|.|.:::...|....|||||.
  Fly    85 TETGVRSGVDKVYTPKAYNTRTLTSDVAVLKLKAPIS-GPKVSTIELCNTSFKAGDLIKVSGWGQ 148

  Fly   156 LSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTMICAAASG-KDACQGDSGGPLVSGGV 219
            ::..:.::..|::.|:|.::.:..|.|. |.....|.:||.||:..| ||||:||||||.|..|.
  Fly   149 ITERNKAVSMQVRSVDVALIPRKACMSQ-YKLRGTITNTMFCASVPGVKDACEGDSGGPAVYQGQ 212

  Fly   220 LVGVVSWGYGCAYSNYPGVYADVAALRSWV 249
            |.|:||||.|||..:.||||.:|..:||::
  Fly   213 LCGIVSWGVGCARKSSPGVYTNVKTVRSFI 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 81/219 (37%)
CG32271NP_728833.1 Tryp_SPc 24..242 CDD:214473 81/219 (37%)
Tryp_SPc 25..244 CDD:238113 80/220 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.