DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and KLKB1

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_011530232.1 Gene:KLKB1 / 3818 HGNCID:6371 Length:649 Species:Homo sapiens


Alignment Length:240 Identity:87/240 - (36%)
Similarity:122/240 - (50%) Gaps:26/240 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RIVGGSATTISSFPWQISLQ---RSGSHSCGGSIYSSNVIVTAAHCLQSVS-ASVLQIRAGSSYW 90
            |||||:.::...:|||:|||   .:..|.||||:.....::|||||...:. ..|.:|.:|....
Human   401 RIVGGTNSSWGEWPWQVSLQVKLTAQRHLCGGSLIGHQWVLTAAHCFDGLPLQDVWRIYSGILNL 465

  Fly    91 SSGGVTFSVSSFKN---HEGYNANTMVNDIAIIKINGALTFSSTIKAIGLASSNPANGAAAS--- 149
            |........|..|.   |:.|..:...:|||:||:...|.::...|.|.|    |:.|..::   
Human   466 SDITKDTPFSQIKEIIIHQNYKVSEGNHDIALIKLQAPLNYTEFQKPICL----PSKGDTSTIYT 526

  Fly   150 ---VSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTMICAA--ASGKDACQGD 209
               |:||| .|.....|.:.||.||:.:|:..:|......|  :|...|:||.  ..|||||:||
Human   527 NCWVTGWG-FSKEKGEIQNILQKVNIPLVTNEECQKRYQDY--KITQRMVCAGYKEGGKDACKGD 588

  Fly   210 SGGPLV--SGGV--LVGVVSWGYGCAYSNYPGVYADVAALRSWVI 250
            ||||||  ..|:  |||:.|||.|||....||||..||....|::
Human   589 SGGPLVCKHNGMWRLVGITSWGEGCARREQPGVYTKVAEYMDWIL 633

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 86/237 (36%)
KLKB1XP_011530232.1 APPLE 21..104 CDD:128519
APPLE 111..194 CDD:128519
APPLE 212..295 CDD:128519
APPLE 303..386 CDD:128519
Tryp_SPc 401..632 CDD:214473 86/237 (36%)
Tryp_SPc 402..632 CDD:238113 85/236 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.