DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and CG13430

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001027441.1 Gene:CG13430 / 3772580 FlyBaseID:FBgn0034518 Length:267 Species:Drosophila melanogaster


Alignment Length:234 Identity:104/234 - (44%)
Similarity:142/234 - (60%) Gaps:15/234 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 DGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTAAHC-LQSVSASVLQIRAGSSYWS 91
            |||||||..|.|:.||.|:|||....|:|||:|.|.|:|:||||| |:........||||||.|:
  Fly    29 DGRIVGGWETHITFFPHQVSLQLGTRHACGGTIISPNIILTAAHCVLEYSKPQYYVIRAGSSDWT 93

  Fly    92 SGGVTFSVSSFKNH-EGYNANTMVNDIAIIKINGALTFSSTIKAIGLASSN----PANGAAASVS 151
            .||....|.....| |.::...|.|||||:::...|.:|..|:.|.||:|.    |.  |...||
  Fly    94 KGGSYIRVKKIIPHPEFHDPTRMNNDIAIVQLQQPLVYSQDIRPISLATSKDIIMPT--AQLFVS 156

  Fly   152 GWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTMICAA--ASGKDACQGDSGGPL 214
            |||:.|........:|:|..|::..|:|||.:.:|.|: :.:||.||.  |.|:|:|||||||||
  Fly   157 GWGSTSISQMQPEKRLRYTVVHLRDQNQCARNYFGAGT-VTNTMFCAGTQAGGRDSCQGDSGGPL 220

  Fly   215 VS---GGV-LVGVVSWGYGCAYSNYPGVYADVAALRSWV 249
            |:   |.: |.|:||||:|||.:.:||:|..|:|...|:
  Fly   221 VTSIDGRLKLYGIVSWGFGCANAMFPGIYTKVSAYDDWI 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 101/230 (44%)
CG13430NP_001027441.1 Tryp_SPc 31..259 CDD:214473 101/230 (44%)
Tryp_SPc 32..262 CDD:238113 101/231 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443259
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.