DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and CG30414

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001163264.1 Gene:CG30414 / 37705 FlyBaseID:FBgn0050414 Length:305 Species:Drosophila melanogaster


Alignment Length:308 Identity:83/308 - (26%)
Similarity:129/308 - (41%) Gaps:74/308 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKFVIL-LSAVACA--LGGTVPEGLL--------PQLDGRIVGGSATTISSFPWQISLQRSGSHS 55
            :||:.. |:.:.|:  ||...|..||        |:....|.||:...:.|.||.:.:  .|...
  Fly     1 MKFIAAGLALLVCSIQLGEGAPGHLLDSSCGTTKPEFIPMITGGADAGLFSNPWMVKV--LGEKL 63

  Fly    56 CGGSIYSSNVIVTAAHCLQSV------------------------SASVLQIRAG---------- 86
            ||||:.:|..::|||||:.|.                        |..:.:||.|          
  Fly    64 CGGSLITSRFVLTAAHCIVSTHMRVRLGEYKTRFPGKDCSRCVPKSYKLRRIRLGEYDTRFPGKD 128

  Fly    87 ----SSYWSSGGVTFSVSSFKNHEGYNANTMVNDIAIIKINGALTFSSTIKAIG-LASSNPANGA 146
                .||      ..:|.....|..||.| :.|||.::::...:.:|..::.|. |...:.|...
  Fly   129 CCVPKSY------ELAVDRKILHADYNLN-LDNDIGLLRMKSFVQYSDYVRPICLLVEGHMAESP 186

  Fly   147 AASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTMICAAASGKDACQGDSG 211
            ..:::|||..:.|:.|  .:||...|.......|.|.   :..|:..:.||||.:..|||.||||
  Fly   187 IFNITGWGVTNDGTPS--RRLQRATVYNTDLHFCRSK---FTKQVDESQICAAGTNSDACHGDSG 246

  Fly   212 GPL-----VSGGVLV---GVVSWGYGCAYSNYPGVYADVAALRSWVIS 251
            |||     .:|..|.   |:||:|....:|.  .||.:|...|.|:::
  Fly   247 GPLSAQVPFAGSWLTFQYGLVSYGSAACHSF--SVYTNVTHHRDWIVN 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 72/265 (27%)
CG30414NP_001163264.1 Tryp_SPc 41..290 CDD:214473 72/264 (27%)
Tryp_SPc 41..290 CDD:238113 72/264 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.