DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and CG30283

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster


Alignment Length:271 Identity:69/271 - (25%)
Similarity:125/271 - (46%) Gaps:39/271 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VILLSAVACALGGTV-------PEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYS 62
            |:||:|.:..:.|:.       |.|.:|....:|:||....::|.||...:...|...|||::.:
  Fly    10 VVLLAASSVVVLGSESGSFLEHPCGTVPISQFKILGGHNAPVASAPWMAMVMGEGGFHCGGTLIT 74

  Fly    63 SNVIVTAAHCLQSVSASVLQIRAGSSYWSSGGVTFSVSSFKNHEGYNANTMVNDIAIIKINGALT 127
            :..::|:|||   ::...|::|.|.....:....|:|.:...|..|..:.  :|:|::::...:.
  Fly    75 NRFVLTSAHC---IANGELKVRLGVLEREAEAQKFAVDAMFVHTDYYFDQ--HDLALLRLAKRVH 134

  Fly   128 FSSTIKAI-----GLASSNPANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGY 187
            :|..|..|     .|..:...:.......|||.....|||  ..||..::..:.:|:||.. |.:
  Fly   135 YSDNISPICLLLDPLVKNIDEHIVKFRTYGWGKTESRSSS--RMLQKTSLFNLHRSECAKQ-YPH 196

  Fly   188 GSQIRSTMICAAASGKDACQGDSGGPLVSGGVLV-----------GVVSWGYG-CAYSNYPGVYA 240
             .||....|||.::..:.|.|||||||.:   :|           ||.|:|:. |:.:.   |:.
  Fly   197 -QQINRNHICAESANANTCNGDSGGPLTA---IVTYDHVQMVFQFGVTSFGHADCSKAT---VFT 254

  Fly   241 DVAALRSWVIS 251
            :|.....|:::
  Fly   255 NVMTHLDWIVN 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 60/235 (26%)
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 60/235 (26%)
Tryp_SPc 43..266 CDD:238113 61/238 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
11.000

Return to query results.
Submit another query.