DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and CG8299

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster


Alignment Length:231 Identity:93/231 - (40%)
Similarity:127/231 - (54%) Gaps:10/231 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 IVGGSATTISSFPWQISLQRSG---SHSCGGSIYSSNVIVTAAHCLQSVSASVLQIRAGSSY--- 89
            ||||....|:.||:|:|::...   .|.||||||:..|::|||||::...||.::|.||.:.   
  Fly    28 IVGGDQADIADFPYQVSVRLETYMLLHICGGSIYAPRVVITAAHCIKGRYASYIRIVAGQNSIAD 92

  Fly    90 WSSGGVTFSVSSFKNHEGYNANTMVNDIAIIKINGALTFSSTIKAIGLASSNPANGAAASVSGWG 154
            ....||  .||....|.|||..|.||||.:|.....|.:|:.::.|.:|...|.:||.|.|||||
  Fly    93 LEEQGV--KVSKLIPHAGYNKKTYVNDIGLIITREPLEYSALVQPIAVALEAPPSGAQAVVSGWG 155

  Fly   155 TLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTMICAA--ASGKDACQGDSGGPLVSG 217
            ..:....::|:.|:.|.:.|:.:|.|.:........:...|:||.  ..|||.|.|||||||...
  Fly   156 KRAEDDEALPAMLRAVELQIIEKSTCGAQYLTKDYTVTDEMLCAGYLEGGKDTCNGDSGGPLAVD 220

  Fly   218 GVLVGVVSWGYGCAYSNYPGVYADVAALRSWVISNA 253
            ||||||||||.||....:||||..|.:...|:...|
  Fly   221 GVLVGVVSWGVGCGREGFPGVYTSVNSHIDWIEEQA 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 91/225 (40%)
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 91/225 (40%)
Tryp_SPc 28..255 CDD:238113 92/228 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452500
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
76.860

Return to query results.
Submit another query.