DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and Prss56

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_003750778.1 Gene:Prss56 / 363274 RGDID:1563955 Length:607 Species:Rattus norvegicus


Alignment Length:233 Identity:75/233 - (32%)
Similarity:109/233 - (46%) Gaps:15/233 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 GRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTAAHCLQSVSASVL-QIRAGSSYWSS 92
            |||||||...:.::||.:.||..|...|||.:.:::.::|||||....|..:| .:.........
  Rat   110 GRIVGGSTAPLGAWPWLVRLQLGGLPLCGGVLVAASWVLTAAHCFAGASNELLWTVMLAEGPQGE 174

  Fly    93 GGVTFSVSSFKNHEGYNANTMVNDIAIIKINGALTFSSTIKAIGL--ASSNPANGAAASVSGWGT 155
            ......|:....|..::..|..||:|::::...:......:.|.|  .|..|..|...:::|||.
  Rat   175 QAEEVQVNRILPHPKFDPQTFHNDLALVQLWTPVNSEGPARPICLPEGSREPPAGTPCTIAGWGA 239

  Fly   156 LSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTMICAA--ASGKDACQGDSGGPLVSG- 217
            | :........::...|.::|...| ....|.|.. .|||:||.  |.|.|:|||||||||... 
  Rat   240 L-FEDGPESEAVREARVPLLSADTC-QKALGPGLS-PSTMLCAGYLAGGIDSCQGDSGGPLTCSE 301

  Fly   218 ------GVLVGVVSWGYGCAYSNYPGVYADVAALRSWV 249
                  .||.||.|||.||.....||||..||..:.|:
  Rat   302 PGPRPREVLFGVTSWGDGCGEPGKPGVYTRVAVFKDWL 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 73/230 (32%)
Prss56XP_003750778.1 Tryp_SPc 112..342 CDD:238113 73/231 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.